Skip to content
MX Tickets Logo
MX Tickets Logo
MX Tickets Logo
MX Tickets Logo

Partner

O'NEAL logoO'NEAL logo

Legal

  • Privacy Policy
  • Terms and Conditions
  • Privacy Options
  • Cookie Policy

Company

  • Track Owner?
  • Claim Track
  • Logo Pack
  • Instagram
  • Facebook

Discover

  • Upcoming Events
  • Race Atlas

MX Tickets App

Download on the App StoreGet it on Google Play

Language

Area

Appearance


ยฉ 2026 MX Tickets - a brand of robin heat GmbH

Race Atlas
/United States
/Idaho
๐Ÿ‡บ๐Ÿ‡ธ

Idaho

Championships and race series racing in Idaho, with every upcoming race weekend.

AKVTNHMENYCTMAWAMTNDSDMNWIMIPANJRIOR
ID
WYNEIAILINOHVA
DC
DE
NVUTCOKSMOTNKYWVNCMDCAAZNMOKARMSALGASCTXLAFLHI

Upcoming in Idaho

0

No upcoming races right now.

Series racing in Idaho

6
AMA / FIM North America

AMA/FIM Arenacross

The national, top-tier arenacross championship in North America, promoted by AX Promotions under AMA sanction and recognized by FIM North America, with rounds across the US and Canada each winter.

2026 ยท Rounds: 9
AMA / MX Sports

Loretta Lynn's

The biggest amateur race in the world, and the one every American pro has ridden. Six days at Loretta Lynn's Ranch in Tennessee, 1,500+ riders across 36 classes, all of whom earned their spot through a nationwide qualifying process.

2026 ยท Rounds: 73

HCMA

Grassroots Flathead-area Montana motocross points series run via a public Facebook group (est. 2018, 3.7K members) administered by Bruce Holler and Jenny Nygren. What "HCMA" stands for is not spelled out anywhere, and there is no website (hcmamt.org is an unrelated parked domain). The schedule comes from the group's own 'Here is our updated 2026 schedule!' post: four weekends, no round numbers. An earlier version of the 2026 schedule also carried a Great Falls MT round and a Helena MT round at 'Bummer MX', so more dates may yet appear.

2026 ยท Rounds: 4
AMA-featured, run by Grassroots Promotions

Off-Road Challenge

Six-round Grand Prix-style series run by Grassroots Promotions/Grassroots MX (same promoter as the sibling motocross-only RMX Series) across Arizona, Idaho and Utah, presented by title sponsor MSR and Rocky Mountain ATV/MC. Each round combines the host venue's full motocross track with 4-6 miles of prepped off-road course. Rounds 1-3 are the regular season; Rounds 3-6 are double-points 'Playoff' rounds, with Round 3 (Sat) and Round 4 (Sun) forming the back-to-back 'Dynamite Grand Prix' doubleheader weekend at Cache Valley MX. Round 1/6's promoted 'Mesquite, NV' branding sits directly on the AZ/NV line; the venue's street address is in Littlefield, AZ. It is a self-contained 6-round points championship with its own results/points table (resultsmx.com) and AMA #1 series plates. Some listings print a different 'Round N' on these same events, counting through Grassroots MX's whole combined Western calendar (Moto86 Series, RMX Series, Grassroots Off-Road, Loretta Lynn area qualifiers and standalone signature races like the AMA Thanksgiving Classic all together); those numbers are not this series' round order.

6
Next up
Mesquite MX
14 Nov 2026

Prospector Series

Cross-state amateur motocross points series with 5 rounds spanning southern Idaho and northeastern Nevada (Magic Valley MX in Twin Falls, Skyline MX Park in Kuna, and Hillside Motorsports/Elko Motocross Club in Elko NV).

2026 ยท Rounds: 5
AMA-featured, run by Grassroots Promotions

RMX Series

Regional 8-round AMA-featured amateur/pro motocross championship series run by Grassroots Promotions/Grassroots MX across Nevada/Arizona, Utah, Idaho and Wyoming, presented by title sponsor Rocky Mountain ATV/MC. State-championship rounds are folded into the schedule for Wyoming, Idaho and Utah. Round 1's promoted 'Mesquite, NV' branding sits directly on the AZ/NV line. Its published street address (970 E Peppermill Palms Blvd) is in Littlefield, AZ. The series also runs a season-ending, non-points 'Celebration of Champions' awards event, with no date set yet.

2026 ยท Rounds: 8
Racing near you

Your local track sells tickets here

Tracks on MX Tickets sell gate entry, practice days and camping online. Book before you turn up.

Find events